PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009128570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 248aa    MW: 28711.4 Da    PI: 5.6653
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009128570.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK77.51.5e-24117167252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +k +s+e++s yF++pi++AA eL+v+lT+LKr+CR++G  RWPhRk+ sl
  XP_009128570.1 117 SKALSMETISLYFYMPITQAATELDVGLTLLKRRCRELGFTRWPHRKLMSL 167
                     5899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.31395188IPR003035RWP-RK domain
PfamPF020422.0E-19120167IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MADHTLNEEN PFSVLTHSLS FDDHSLLTYP SFEWEEEHLF MNNSVYEAFP LPTPLPDLEP  60
LSQDVLESYS SASLNVTDQN RGQGDLEQNT EEEAVQETTN KRKINRYVTT YTTFSTSKAL  120
SMETISLYFY MPITQAATEL DVGLTLLKRR CRELGFTRWP HRKLMSLLAL ISNVKLQKFE  180
GGENAEKLKN TLLEMLENQK RRIEENPDLE FDDKTKRLRQ ACFKATHKMK KKASLKSDHL  240
CGFAKEFN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128570.10.0PREDICTED: protein RKD2-like
SwissprotQ9CA661e-94RKD2_ARATH; Protein RKD2
TrEMBLM4CVA60.0M4CVA6_BRARP; Uncharacterized protein
STRINGBra008153.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-85RWP-RK domain-containing protein